PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G34040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 24184.6 Da    PI: 7.7033
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G34040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.5e-29959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++nrqvtfskRr gilKKA E+SvLCdaev v+ifss gkly+y+s
  LPERR01G34040.1  9 KRIENSTNRQVTFSKRRSGILKKAREISVLCDAEVGVVIFSSAGKLYDYCS 59
                     79***********************************************96 PP

2K-box76.56.9e-2671167197
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                      yq++sgk l+++k++sl+ e++++kke++n+q e+Rhl+GedL+sL+ keL  +e++L+++l ++ +k ++++ +++++ ++ e+e++    +L
  LPERR01G34040.1  71 YQTNSGKILWDEKHKSLSAEIDRIKKENDNMQIELRHLKGEDLNSLQPKELIMIEEALDNGLVNVNDKLMDHWERHVRNDKMLEDENKLLAFKL 164
                      89999999************************************************************************************** PP

            K-box  95 rkk 97 
                      +++
  LPERR01G34040.1 165 HQQ 167
                      998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.039161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-34296IPR002100Transcription factor, MADS-box
CDDcd002651.19E-43280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-1582164IPR002487Transcription factor, K-box
PROSITE profilePS5129712.26684170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRSGILK KAREISVLCD AEVGVVIFSS AGKLYDYCSP  60
KTSLSRILEK YQTNSGKILW DEKHKSLSAE IDRIKKENDN MQIELRHLKG EDLNSLQPKE  120
LIMIEEALDN GLVNVNDKLM DHWERHVRND KMLEDENKLL AFKLHQQEIA LSGSMRDLEL  180
GYHPDRDFAA QMPITFRVQP SHPNLQENN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-20175173Myocyte-specific enhancer factor 2B
1tqe_R3e-20175173Myocyte-specific enhancer factor 2B
1tqe_Q3e-20175173Myocyte-specific enhancer factor 2B
1tqe_P3e-20175173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0708940.0AK070894.1 Oryza sativa Japonica Group cDNA clone:J023072H23, full insert sequence.
GenBankAY5519240.0AY551924.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS219 mRNA, complete cds.
GenBankRICOSMA0.0L37526.1 Oryza sativa MADS-box protein (MADS2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645133.11e-154PREDICTED: MADS-box transcription factor 2
SwissprotQ407021e-155MADS2_ORYSJ; MADS-box transcription factor 2
TrEMBLA0A0D9V8M81e-154A0A0D9V8M8_9ORYZ; Uncharacterized protein
STRINGOB01G48280.11e-153(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.16e-76MIKC_MADS family protein